Aryal et al, 2011, metabolic labelling of Cyanothece protein synthesis

Selected Cell

Cell:

Value:

Sheet1

100

101

102

103

104

105

106

107

108

109

110

111

112

113

114

115

116

117

118

119

120

121

122

123

124

125

126

127

128

129

130

131

132

133

134

135

136

137

138

139

140

141

142

143

144

145

146

147

148

149

150

151

152

153

154

155

156

157

158

159

160

161

162

163

164

165

166

167

168

169

170

171

172

173

174

175

176

177

178

179

180

181

182

183

184

185

186

187

188

189

190

191

192

193

194

195

196

197

198

199

200

Peptide sequence	ORF**	Functional categories	Protein description	D1-1	D1-5	D1-9	L1-1	L1-5	L1-9	D2-1	D2-5	D2-9	L2-1	L2-5	L2-9	D3-1
NTTDKPIGVGFGISEPEHALQVK	cce_2130	Amino acid biosynthesis: Aromatic amino acid family	tryptophan synthase alpha subunit	0.012464137		0.007913116	0.006290108	0.014461987	0.015062907	0.015447155	0.018894186		0.021827482	0.048307825	0.051601284	0.044864039
RAELDIDQVIPIAQEVITAIAQTGDK	cce_2314	Amino acid biosynthesis: Aromatic amino acid family	histidinol dehydrogenase		0.034407358	0.039672279		0.06600628	0.074134793		0.123683669	0.111035501	0.104639373		0.120149654	0.101308344
GNTFGHLFR	cce_4200	Amino acid biosynthesis: Aromatic amino acid family	chorismate synthase												0.176746885
LYQGNYQQSEVYNENPVEVAR	cce_4140	Amino acid biosynthesis: Aromatic amino acid family	phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase		0.034604808			0.060019375			0.045402948			0.104296676
LYPDPVSTK	cce_3292	Amino acid biosynthesis: Aromatic amino acid family	histidinol phosphate aminotransferase		0.108113075	0.12877659		0.082570809		0.210857498				0.182591127
TVTSESEETTLAAK	cce_4200	Amino acid biosynthesis: Aromatic amino acid family	chorismate synthase								0.098784972		0.093754658
ITPIPSVGLYVPR	cce_2314	Amino acid biosynthesis: Aromatic amino acid family	histidinol dehydrogenase									0.310596879
FILPTDIGQVEIREGVPSEVITR	cce_4440	Amino acid biosynthesis: Aromatic amino acid family	3-dehydroquinate synthase		0.013905103	0.02921015		0.034689801
SLSIDTQGANVNAH	cce_0510	Amino acid biosynthesis: Aspartate family	homoserine kinase								0.091589541	0.110419457	0.113554868		0.124047793	0.127966718
AVSQAEDMMLVGAVDKNPNYR	cce_2936	Amino acid biosynthesis: Aspartate family	dihydrodipicolinate reductase				0.121295562		0.013987926		0.023993433				0.044748833
IQTLAGIIIPR	cce_4146	Amino acid biosynthesis: Aspartate family	diaminopimelate epimerase	0.036656715											0.078090212
TKYGPVAGEPGLR	cce_2693	Amino acid biosynthesis: Aspartate family	aspartate aminotransferase		0.031840449								0.128314442		0.098686954
IAESVGNFPIMLYNIPGR	cce_0294	Amino acid biosynthesis: Aspartate family	dihydrodipicolinate synthase					0.040896679	0.022182379	0.021865413	0.084683106	0.076330909	0.067454339		0.105505947
EIPTTLTKGEEK	cce_4146	Amino acid biosynthesis: Aspartate family	diaminopimelate epimerase												0.172021914
KAFEDILPDEIVWR	cce_4003	Amino acid biosynthesis: Aspartate family	asparagine synthetase		0.125175054	0.081081173									0.711364908
LAEGTPVIVNTTAETDYK	cce_2693	Amino acid biosynthesis: Aspartate family	aspartate aminotransferase	0.032925431		0.023398057			0.041740842	0.051798264	0.064079129	0.074778094	0.09774008	0.079627703
TLSYGDAIFNIAR	cce_0510	Amino acid biosynthesis: Aspartate family	homoserine kinase	0.031897595		0.035609442					0.081616406		0.085542789	0.084741039
AHSEAINLEFKAPFSVAQAR	cce_0293	Amino acid biosynthesis: Aspartate family	"aspartate-semialdehyde dehydrogenase	USG-1 related"		0.072516774	0.043279069	0.063907564				0.071924165	0.148899622	0.165369294
NYFPMPIDASGKDDVLVGR	cce_0293	Amino acid biosynthesis: Aspartate family	"aspartate-semialdehyde dehydrogenase	USG-1 related"	0.083417491		0.105405021			0.220283038	0.181083225	0.250548206	0.215909767	0.22210897
AFVIIPDGYVALGK	cce_1455	Amino acid biosynthesis: Aspartate family	threonine synthase				0.172526671					0.374427522
VGFVVGNAEIIQGLR	cce_3727	Amino acid biosynthesis: Aspartate family	aminotransferase	0.012761726							0.064430493
VLAGTGANSTQHAVEMTEK	cce_0294	Amino acid biosynthesis: Aspartate family	dihydrodipicolinate synthase					0.063052663			0.109615533
LEGVETVGK	cce_4146	Amino acid biosynthesis: Aspartate family	diaminopimelate epimerase								0.170963214
SLVYGLEK	cce_2936	Amino acid biosynthesis: Aspartate family	dihydrodipicolinate reductase					0.00212993		0.003633386
LAEGTPVIVNTTAETDYKITPEQLR	cce_2693	Amino acid biosynthesis: Aspartate family	aspartate aminotransferase		0.019254239
GPDANGIFVVPDGSGILGHQR	cce_4003	Amino acid biosynthesis: Aspartate family	asparagine synthetase	0.141417864
WADRPVLV	cce_4003	Amino acid biosynthesis: Aspartate family	asparagine synthetase	0.240772266
VLSFAHGFNIHFGQIVPPETVDVIMVAPK	cce_2120	Amino acid biosynthesis: Branched chain family	ketol-acid reductoisomerase		0.030435973	0.019370795	0.022423213	0.034699963	0.008367574	0.019178237	0.023793786	0.029705744	0.026955519	0.028373194	0.03481629	0.019738089
EFVLENQSGKPGFTAMRR	cce_2120	Amino acid biosynthesis: Branched chain family	ketol-acid reductoisomerase													0.030365252
MHTFLPIAYFENQFVPFENAK	cce_1614	Amino acid biosynthesis: Branched chain family	branched-chain amino acid aminotransferase		0.034894363	0.038326029	0.041839702	0.055848949	0.059737101	0.059995576	0.068905016	0.091935099	0.101588256	0.076171962	0.069956681	0.053645014
EFVLENQSGKPGFTAMR	cce_2120	Amino acid biosynthesis: Branched chain family	ketol-acid reductoisomerase	0.030555288	0.085176192	0.03482689	0.011309244	0.018002423	0.041702323	0.063986924	0.071346932	0.065528468	0.07786213	0.04046077		0.081159957
AVYQEDIEPNLREGK	cce_2120	Amino acid biosynthesis: Branched chain family	ketol-acid reductoisomerase	0.027565332	0.033309006	0.046217074	0.037061283	0.053256476	0.062092476	0.072891729	0.08989032	0.092318289	0.084994754	0.116729446	0.108048315	0.099904349
MRDSISNTAEYGDLTRGPR	cce_2120	Amino acid biosynthesis: Branched chain family	ketol-acid reductoisomerase	0.027144852	0.037734969	0.038676257	0.027551442	0.046623612	0.058125825	0.059424296	0.061725094	0.066303494	0.094478335	0.059825161		0.105849908
MRDSISNTAEYGDLTR	cce_2120	Amino acid biosynthesis: Branched chain family	ketol-acid reductoisomerase	0.020361286	0.035993391	0.063242807	0.054434168	0.036071515	0.045251948	0.049596227	0.074022784	0.083053411	0.094867678	0.088133423	0.101134218	0.118053684
AVYQEDIEPNLR	cce_2120	Amino acid biosynthesis: Branched chain family	ketol-acid reductoisomerase										0.059724437			0.160791101
AMFSWLKDK	cce_2120	Amino acid biosynthesis: Branched chain family	ketol-acid reductoisomerase	0.083258469	0.083476946	0.123102036	0.139799589	0.111070602	0.162745913	0.217784591	0.243629969	0.263976183		0.279919624		0.343985586
TEAVESGFDEAILMNSQGK	cce_1614	Amino acid biosynthesis: Branched chain family	branched-chain amino acid aminotransferase					0.064760646		0.028662183					0.053870347
QEAEHPIEEVGKDLR	cce_2120	Amino acid biosynthesis: Branched chain family	ketol-acid reductoisomerase			0.037176675	0.033752482	0.041351863	0.044360082						0.065223183
DSISNTAEYGDLTR	cce_2120	Amino acid biosynthesis: Branched chain family	ketol-acid reductoisomerase	0.047788632		0.038164352	0.043247306	0.044483948				0.128051076			0.111086919
DSGINVVVGLYPGSK	cce_2120	Amino acid biosynthesis: Branched chain family	ketol-acid reductoisomerase						0.033938054	0.103700132	0.109968379	0.169326361	0.1416099	0.141514608	0.144111719
AMFSWLK	cce_2120	Amino acid biosynthesis: Branched chain family	ketol-acid reductoisomerase										0.198638063		0.167559663
GNLASEGAVAK	cce_4400	Amino acid biosynthesis: Branched chain family	dihydroxyacid dehydratase			0.220114828	0.2268141		0.321450699		0.471684633				0.451230891
DRVTLMGK	cce_3617	Amino acid biosynthesis: Branched chain family	3-isopropylmalate dehydrogenase				0.045392918	0.066570628	0.113910581	0.090492732		0.116617394		0.14537286
SLNAAAMAISK	cce_4227	Amino acid biosynthesis: Branched chain family	acetolactate synthase large subunit		0.184111086									0.386607498
SAFVLVNAIR	cce_4400	Amino acid biosynthesis: Branched chain family	dihydroxyacid dehydratase											0.441211331
LSIATHALHYGTAAFGGMR	cce_1614	Amino acid biosynthesis: Branched chain family	branched-chain amino acid aminotransferase										0.015839686
ELTGGIYFGEPK	cce_3617	Amino acid biosynthesis: Branched chain family	3-isopropylmalate dehydrogenase						0.05517984	0.111266515			0.106527202
YGLNEPK	cce_3617	Amino acid biosynthesis: Branched chain family	3-isopropylmalate dehydrogenase									0.116268394
MHIESHQYLDLVAMFAPVTK	cce_4227	Amino acid biosynthesis: Branched chain family	acetolactate synthase large subunit									0.169384172
STSVAAGLR	cce_4227	Amino acid biosynthesis: Branched chain family	acetolactate synthase large subunit									0.487224327
NGTLITPGFEQDILEGITR	cce_1614	Amino acid biosynthesis: Branched chain family	branched-chain amino acid aminotransferase						0.244863477		0.057819681
GIPLVGDDIDTDRIIPAR	cce_4582	Amino acid biosynthesis: Branched chain family	"3-isopropylmalate dehydratase	small subunit"	0.054679462	0.088217689	0.076560064	0.099415056	0.147723601		0.19481208	0.217197883
VMNVADAASAADWIMILLPDEVQK	cce_2120	Amino acid biosynthesis: Branched chain family	ketol-acid reductoisomerase							0.030991557
QILREIQSGQFAR	cce_2120	Amino acid biosynthesis: Branched chain family	ketol-acid reductoisomerase		0.004196694		0.007316861	0.023538308
DSISNTAEYGDLTRGPR	cce_2120	Amino acid biosynthesis: Branched chain family	ketol-acid reductoisomerase	0.008712541	0.033231356			0.038909523
ISAAYITSALAK	cce_1614	Amino acid biosynthesis: Branched chain family	branched-chain amino acid aminotransferase	0.054820828	0.087173818		0.088883988
AVEYLQSTGIGDTAFFGPEAEFFVFDDVR	cce_4432	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	"glutamine synthetase	glutamate--ammonia ligase"	0.00314835	0.011608572	0.004415011	0.020771966			0.012117017	0.015798703				0.007974022
TVTFMPKPLFNDNGSGMHTHQSIWK	cce_4432	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	"glutamine synthetase	glutamate--ammonia ligase"												0.040204191
VQFTPHLIPMVR	cce_0064	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	N-acetyl-gamma-glutamyl-phosphate reductase	0.028198921		0.021790798	0.02462593		0.080269717	0.060008833		0.025550289	0.077764005	0.089900475	0.104195719	0.04694541
VEAIIRPFKLDEVK	cce_1775	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	nitrogen regulatory protein P-II	0.015514363	0.006908005	0.01840754			0.015080566	0.03672834	0.036771197	0.038778793	0.034100722	0.022791525	0.040676468	0.053627075
SGAVESLVEDATAEFVTDYAFK	cce_4370	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	argininosuccinate synthetase	0.021889113	0.020679198	0.03366004	0.036203826	0.026943232	0.03342847	0.040670336	0.045702504	0.044930042	0.053472602	0.046547727	0.058096605	0.069076298
IALVNAGIVGMTISEVR	cce_1775	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	nitrogen regulatory protein P-II	0.032303901	0.030112517	0.03696433	0.033811916	0.039570887	0.037506572	0.05959666	0.064414104	0.051852002	0.076251409	0.096621603	0.053933306	0.07308114
DYQPLPMIIEQAK	cce_3251	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	ornithine carbamoyltransferase		0.015957415		0.027291409				0.027537	0.065314034	0.022179879	0.075556032	0.081850516	0.077531097
YRGSEYTVEFLQK	cce_1775	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	nitrogen regulatory protein P-II	0.024397146	0.030940248	0.030998814	0.030777344	0.032664361	0.030716096	0.052093545	0.052472252	0.06630891	0.054400312	0.062161462	0.071024415	0.081558048
DLESLTLTSDVTHYKK	cce_4370	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	argininosuccinate synthetase													0.083348884
WNTGREEEGGNLGYKPGYK	cce_4432	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	"glutamine synthetase	glutamate--ammonia ligase"	0.030636182	0.030100967	0.037685599	0.034334506	0.04509766	0.044011706	0.062573367	0.067390997	0.065428273	0.072250294	0.07026944	0.051331413
EQTIAYGEKFGLDFPVKK	cce_4370	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	argininosuccinate synthetase	0.034290434	0.049899974		0.039092413			0.060008031	0.066138967		0.08055708	0.085573363		0.108476712
IRTGESDLEAI	cce_1775	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	nitrogen regulatory protein P-II	0.018806876		0.026921322	0.021702993	0.037282779	0.05431772	0.074419344	0.09348626	0.093532721	0.042066535		0.046280757	0.130280654
YQQDFEPLMPGFAYVPYNDIK	cce_3094	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	N-acetylornithine aminotransferase	0.038573118	0.036875153	0.058378663	0.034558989	0.064919254	0.080126989	0.090843284	0.095699319	0.130442927	0.122719402	0.157974569	0.122962835	0.183374135
AAEGFIYIWGLPTR	cce_4370	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	argininosuccinate synthetase	0.067384906	0.108328197	0.067794493	0.070480763	0.126640807	0.27273899	0.179694482	0.258014323	0.174531984	0.316115631	0.396937075	0.334682103	0.198156619
LDNEVNPMR	cce_4432	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	"glutamine synthetase	glutamate--ammonia ligase"	0.081557144	0.067724243	0.055614666	0.058954241		0.076711168	0.164375734	0.146911727	0.180291326	0.155787601	0.189003377	0.179374317
SASVRIPLSGPNPK	cce_4432	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	"glutamine synthetase	glutamate--ammonia ligase"	0.076126488	0.091418016	0.087500136	0.091156327	0.100038582	0.115877759	0.154269509	0.157215798	0.41564957	0.181334234	0.176929462	0.202051497
GVEETYSHLIYR	cce_4370	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	argininosuccinate synthetase	0.071132601	0.100228117	0.103279048	0.127654192	0.110977244	0.148056988	0.172688999	0.15248828	0.216487745	0.22307755	0.222438832	0.288113591	0.269112772
THTTLTENPAK	cce_3094	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	N-acetylornithine aminotransferase	0.042024921	0.317875527	0.332018916	0.957941665		0.238178532		0.606810962		0.488102539		0.550948653	0.499096045
EEEGGNLGYKPGYK	cce_4432	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	"glutamine synthetase	glutamate--ammonia ligase"	0.019870472							0.023106461		0.035106268		0.014320717
GSEYTVEFLQK	cce_1775	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	nitrogen regulatory protein P-II				0.015433451				0.033280882		0.023446333	0.030524651	0.030835989
SIEAGPLEDPMTEPPEEIYLMTK	cce_4370	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	argininosuccinate synthetase			0.027446439			0.033682761			0.051326163	0.048673225		0.054863148
AQTPQEVLK	cce_4432	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	"glutamine synthetase	glutamate--ammonia ligase"	0.090737751	0.101147711	0.102126595	0.09967333	0.073194436	0.129372686		0.192394602	0.13054367	0.202798771	0.219509519	0.235758785
IPLSGPNPK	cce_4432	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	"glutamine synthetase	glutamate--ammonia ligase"	0.07584402	0.083094556			0.090301089		0.213856722		0.220582733			0.260910617
TLATITATGQPK	cce_3094	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	N-acetylornithine aminotransferase		0.325887499		0.35051008			0.451469431	0.471432632			0.611008116	0.547735952
DLESLTLTSDVTHYK	cce_4370	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	argininosuccinate synthetase											0.010873889
MIQDNNIKIIDLK	cce_4432	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	"glutamine synthetase	glutamate--ammonia ligase"	0.034126488		0.023462635		0.027849556						0.02028522
TIEEENILQNVQAR	cce_3094	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	N-acetylornithine aminotransferase	0.116461378		0.133370897		0.204037243	0.108134571		0.312882023		0.158805507	0.158736849
GESEKISVGIIGASGYGGVQLVR	cce_0064	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	N-acetyl-gamma-glutamyl-phosphate reductase											0.570954887
HTPEIEQISSDLAGHEVK	cce_0064	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	N-acetyl-gamma-glutamyl-phosphate reductase										0.044761339
QSDYSIYSPNLATYGEDDHFDHK	cce_4370	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	argininosuccinate synthetase	0.008180175	0.013671394	0.017742393	0.01377648	0.019406827	0.011716956		0.022841594	0.01520465	0.047529351
ESLDAFIDHTQER	cce_4370	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	argininosuccinate synthetase		0.047361559	0.034119785	0.044978451	0.038854092	0.050660683	0.081797069		0.099948742	0.089915824
AIAQKDPTLFTDVR	cce_3094	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	N-acetylornithine aminotransferase		0.155526131	0.138720118		0.164685634	0.219915161	0.206639855		0.280277992	0.241514569
GLIEAHFER	cce_4353	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	ferredoxin-dependent glutamate synthase				0.55830637	0.461976871					0.800473605
EVPVNPDVLGVQAK	cce_4353	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	ferredoxin-dependent glutamate synthase	0.243335835	0.408788742	0.287023412	0.472077203	0.45116659		0.768357681		0.718018286
IPIFQPYQINDELLQKADK	cce_3251	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	ornithine carbamoyltransferase				0.011380035				0.029154944
VATPKDYQPLPMIIEQAK	cce_3251	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	ornithine carbamoyltransferase	0.020506023	0.018115061	0.018443531	0.02685934	0.032817473			0.03983352
IPIFQPYQINDELLQK	cce_3251	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	ornithine carbamoyltransferase								0.04204064
ANALYESR	cce_4370	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	argininosuccinate synthetase								0.240249548
SSPFSIDRNLLGR	cce_4370	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	argininosuccinate synthetase	0.374215768			0.079617039				0.248941176
FATLIEAADYLMTYK	cce_4432	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	"glutamine synthetase	glutamate--ammonia ligase"		0.031379206	0.00210461			0.016932806	0.016322676
QSDYSIYSPNLATYGEDDHFDHKAAEGFIYIWGLPTR	cce_4370	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	argininosuccinate synthetase						0.059410294
YQQDFEPLMPGFAYVPYNDIKAIEHAIADIDEGNRR	cce_3094	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	N-acetylornithine aminotransferase		0.021589865	0.025930339	0.015454154	0.03322384
KYGNTGFSGELK	cce_4353	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	ferredoxin-dependent glutamate synthase					0.291275695
FGVTPEYLMNGQQIEIK	cce_4353	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	ferredoxin-dependent glutamate synthase	0.183944758	0.181069784	0.26143292	0.251189502	0.301542591
DLQEDKEAIFDGVK	cce_0232	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	L-argininosuccinate lyase				0.025274968
VLAPAREWK	cce_4370	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	argininosuccinate synthetase		0.10072874	0.130968225	0.165014022
LREMIPEIAEVEQAF	cce_1017	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	NifU-like protein				0.458203169
ISGTLAKK	cce_4353	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	ferredoxin-dependent glutamate synthase	0.42044889			0.484076433
VFGHLQGMLVLMK	cce_0232	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	L-argininosuccinate lyase			0.9421722
KGVEETYSHLIYR	cce_4370	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	argininosuccinate synthetase		0.044710512
AYKIGENGANAEAYDHYELYQK	cce_4353	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	ferredoxin-dependent glutamate synthase		0.056386978
MAQGAKPGEGGQLPGK	cce_4353	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	ferredoxin-dependent glutamate synthase		0.135654136
LFKGNANIVGR	cce_4370	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	argininosuccinate synthetase	0.078799479
ANADIIQISGHDGGTGASPLSSIK	cce_4353	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	ferredoxin-dependent glutamate synthase	0.153716661
VESPVLNETELEQIK	cce_4353	Amino acid biosynthesis: Glutamate family / Nitrogen assimilation	ferredoxin-dependent glutamate synthase	0.966461339
ITDVDGFPINVPPSNYMLFTVHR	cce_2134	Amino acid biosynthesis: Serine family / Sulfur assimilation	D-3-phosphoglycerate dehydrogenase	0.032283895	0.027516918	0.049574628	0.036328387	0.040402638	0.056019671	0.077807441	0.055681552	0.065046602	0.052279986	0.063199526	0.066085079	0.053526874
ITANMEGVPIDDAIQIDDHEALR	cce_0210	Amino acid biosynthesis: Serine family / Sulfur assimilation	cysteine synthase	0.007362449	0.01148603	0.040410928	0.022246613		0.021943582	0.024108523	0.03247601	0.042700005	0.040356553	0.046039346	0.037104567	0.054411484
GVIHSFADGRIEDTGPLTK	cce_3870	Amino acid biosynthesis: Serine family / Sulfur assimilation	sulfatase	0.019910221	0.013424623	0.0204989	0.025822745	0.034368003	0.0395184	0.043656127	0.043609263	0.054190372	0.046677442	0.061601205	0.059625843	0.058497091
GVIHSFADGRIEDTGPLTKK	cce_3870	Amino acid biosynthesis: Serine family / Sulfur assimilation	sulfatase	0.018960573	0.01976673	0.021174976	0.022055477	0.036329403	0.030754026	0.033210252	0.043663415	0.052525636	0.054892038	0.056186951	0.061326963	0.064828127
IIPEYDAMMLR	cce_2134	Amino acid biosynthesis: Serine family / Sulfur assimilation	D-3-phosphoglycerate dehydrogenase	0.03713965	0.046438935	0.05337784	0.042991641	0.048755963	0.046685848	0.084306017	0.058576292		0.089962924	0.072303402	0.102268772	0.143311933
GGTIDEDALAEAIAEGK	cce_2134	Amino acid biosynthesis: Serine family / Sulfur assimilation	D-3-phosphoglycerate dehydrogenase	0.038363867	0.04729471	0.348922795	0.036899782	0.030832124	0.019511545	0.08005554	0.398475419	0.075887842	0.048769077	0.08680752	0.111144716	0.149205307
SAVNIPGLTPDVMEK	cce_2134	Amino acid biosynthesis: Serine family / Sulfur assimilation	D-3-phosphoglycerate dehydrogenase	0.303259875	0.481312973	0.381951088	0.504794054	0.461252032	0.626063931	0.336681927	0.302889461	0.270753873	0.337326437	0.263441782	0.374566398	0.488328288
AEFLNPGGSVKDR	cce_0210	Amino acid biosynthesis: Serine family / Sulfur assimilation	cysteine synthase												0.100954742
VSGIRDAYTVKL	cce_2134	Amino acid biosynthesis: Serine family / Sulfur assimilation	D-3-phosphoglycerate dehydrogenase	0.07631801	0.087622467	0.061534173		0.080004274			0.173892116	0.122997931	0.1891428	0.110069437	0.148430729
EIIAAGTQLK	cce_2134	Amino acid biosynthesis: Serine family / Sulfur assimilation	D-3-phosphoglycerate dehydrogenase		0.08367373	0.055311253			0.066510894				0.196887286		0.280749952
DEHPLFPK	cce_4658	Amino acid biosynthesis: Serine family / Sulfur assimilation	sulfate adenylyltransferase							0.394488783		0.400423384			0.721719656
VLVSDPIDQVGIDILSQVAQVDVK	cce_2134	Amino acid biosynthesis: Serine family / Sulfur assimilation	D-3-phosphoglycerate dehydrogenase	0.018948503		0.027727002								0.036006694
ASFQAIAVEPTSSPVLSGGKPGGHK	cce_1473	Amino acid biosynthesis: Serine family / Sulfur assimilation	cysteine synthase A											0.202387909
VILAINPSAMR	cce_4658	Amino acid biosynthesis: Serine family / Sulfur assimilation	sulfate adenylyltransferase					0.38235962						0.678565605
VIYDQGAVNLAGPVWLLQR	cce_4658	Amino acid biosynthesis: Serine family / Sulfur assimilation	sulfate adenylyltransferase											0.87004606
WPGHIEPGTVSNDIISHLDWMPTLLAAAGDPDVKEK	cce_3870	Amino acid biosynthesis: Serine family / Sulfur assimilation	sulfatase										0.013940407
IGVNMINSAEREGLIIPGK	cce_1473	Amino acid biosynthesis: Serine family / Sulfur assimilation	cysteine synthase A	0.143948786	0.221297695	0.227042193	0.206336667		0.233471229				0.20878412
GLGFSKEDRDTNIR	cce_3972	Amino acid biosynthesis: Serine family / Sulfur assimilation	adenylylsulfate kinase										0.376019744
IASPAEKAEFLAQADKLPK	cce_4658	Amino acid biosynthesis: Serine family / Sulfur assimilation	sulfate adenylyltransferase							0.657399162			0.766237084
VAEELDNAIWANQFDNLANR	cce_0210	Amino acid biosynthesis: Serine family / Sulfur assimilation	cysteine synthase				0.018808408					0.018894232
IAGAALDVFEEEPLGESK	cce_2134	Amino acid biosynthesis: Serine family / Sulfur assimilation	D-3-phosphoglycerate dehydrogenase									0.087700066
QEAASFTIDQVLEELVPPHS	cce_3870	Amino acid biosynthesis: Serine family / Sulfur assimilation	sulfatase								0.012585703
GVTVWFTGLSGAGK	cce_3972	Amino acid biosynthesis: Serine family / Sulfur assimilation	adenylylsulfate kinase								0.45410932
EGFVGTVGNTPLIR	cce_0210	Amino acid biosynthesis: Serine family / Sulfur assimilation	cysteine synthase							0.070113431
RGEMPPPQFSRPEVAAELIK	cce_4658	Amino acid biosynthesis: Serine family / Sulfur assimilation	sulfate adenylyltransferase	0.10395343		0.11986187	0.165102891	0.307487088
VGMPGADIGLQAEDPTIAEMLKPLGYDTAQFGK	cce_3870	Amino acid biosynthesis: Serine family / Sulfur assimilation	sulfatase	0.231962122				0.378555109
NGVIVLVSAISPYREIRDEVR	cce_3972	Amino acid biosynthesis: Serine family / Sulfur assimilation	adenylylsulfate kinase	0.172164845			0.197210208	0.380146373
IYDKEWLASK	cce_0210	Amino acid biosynthesis: Serine family / Sulfur assimilation	cysteine synthase				0.047991058
MDIKEGFVGTVGNTPLIR	cce_0210	Amino acid biosynthesis: Serine family / Sulfur assimilation	cysteine synthase	0.028955785	0.06582214		0.07745482
AKVLVSDPIDQVGIDILSQVAQVDVK	cce_2134	Amino acid biosynthesis: Serine family / Sulfur assimilation	D-3-phosphoglycerate dehydrogenase			0.012752261
LEGMNPAASVKDR	cce_1473	Amino acid biosynthesis: Serine family / Sulfur assimilation	cysteine synthase A	0.074346251
GRIPDQDPSMYVVMPTQLDPSMAPEGK	cce_4278	"Biosynthesis of cofactors	prosthetic groups	and carriers: Carotenoid"	zeta-carotene desaturase		0.041645816				0.014274197				0.018036741	0.035648469
NLDSISFADWFR	cce_2779	"Biosynthesis of cofactors	prosthetic groups	and carriers: Carotenoid"	zeta-carotene desaturase				0.521524628	0.4284328	0.529732173	0.632428107	0.53837662	0.482959246	0.754529034
EILLKDDNTVK	cce_3754	"Biosynthesis of cofactors	prosthetic groups	and carriers: Carotenoid"	phytoene desaturase									0.857538667	0.852579124
SIIDIAGGYNINALKDVLNVVGSPNK	cce_4278	"Biosynthesis of cofactors	prosthetic groups	and carriers: Carotenoid"	zeta-carotene desaturase			0.02117407		0.032904814		0.042864848
IGPSQPEATKEASLV	cce_3754	"Biosynthesis of cofactors	prosthetic groups	and carriers: Carotenoid"	phytoene desaturase		0.218391697
VVILGTVTHNPNELGGK	cce_0320	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	light-dependent protochlorophyllide reductase
STVIITGASSGVGLYAAK	cce_0320	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	light-dependent protochlorophyllide reductase			0.032184442	0.0534895	0.063707227	0.078842655	0.103987773	0.092737791	0.109904288
NITGGYVSQELAGER	cce_0320	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	light-dependent protochlorophyllide reductase	0.028409699	0.031816462	0.220870492	0.043037219	0.10424194	0.109699738	0.105411463	0.136389606	0.139809276
MWELSEK	cce_0320	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	light-dependent protochlorophyllide reductase			0.040214466	0.065334434	0.114765214	0.41696206	0.119410504	0.143633799	0.126632494
QMLGQPPIIIGFENHGGR	cce_2026	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	CobB/CobQ-like glutamine amidotransferase							0.091261641		0.115539443
GAPIEVIEVADLVTEMK	cce_0802	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	cob(I)alamin adenosyltransferase					0.164492795	0.247605831
NPYVPTVHLNYR	cce_3201	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	"coproporphyrinogen III oxidase	aerobic"	0.156664177		0.307450752	0.235352374
GVGGIFFDYQDGTDPLYRGPHADKAAAK	cce_3201	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	"coproporphyrinogen III oxidase	aerobic"		0.051101994	0.087758209	0.0807284	0.096252526			0.147786921
EKDIIQILEQNGFTIQR	cce_0315	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	magnesium-protoporphyrin O-methyltransferase	0.083860478	0.11482507			0.202593915	0.23889257
QIGGGSPLR	cce_2568	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	ferrochelatase		0.127927883	0.158126457		0.229650073	0.260866544	0.336106456		0.488140599
VLEHTETRDR	cce_4378	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	porphobilinogen deaminase								0.303897717
VAVVGSGPAGSSAAETLAK	cce_3146	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	geranylgeranyl hydrogenase	0.51419992	0.501195372	0.350437227	0.430358483	0.747624763			0.662373276
VQGNIDPGVLFGSQDFIK	cce_2966	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	uroporphyrinogen decarboxylase	0.115166936	0.220588704	0.282280324	0.331558564	0.432977153	0.511435369	0.507831615	0.507552878
ITEAQGEALEQR	cce_2568	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	ferrochelatase				0.125068839		0.234064044
NHYPLFQK	cce_0320	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	light-dependent protochlorophyllide reductase
AGIETYLFER	cce_3146	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	geranylgeranyl hydrogenase	0.401416202		0.457965411	0.473408409	0.725143512	0.795866402		0.744184151	0.730494558
MTFDSYLYK	cce_3146	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	geranylgeranyl hydrogenase				0.581985541				0.523208909
IPPRPDLGNLEGFADGFKEPVSMIDGK	cce_0320	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	light-dependent protochlorophyllide reductase	0.012818543	0.014819996	0.017758849			0.053066219
EVAEEAGITNFLR	cce_2568	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	ferrochelatase			0.215609019	0.068288112		0.216843876
AARGEILDRPPVWMMR	cce_2966	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	uroporphyrinogen decarboxylase	0.202401631	0.211977963	0.336713961			0.517295176
TLNRPNAYTLAYQSR	cce_2568	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	ferrochelatase		0.062635654		0.129070368
IYFPELNRK	cce_2324	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	heme oxygenase				0.204193169
TVVPANPLVQMK	cce_3146	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	geranylgeranyl hydrogenase	0.48430207			0.429802993
GEILDRPPVWMMR	cce_2966	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	uroporphyrinogen decarboxylase			0.247940111
EGTSHSHTLAENTAFTK	cce_2324	"Biosynthesis of cofactors	prosthetic groups	and carriers: Cobalamin	heme	phycobilin and porphyrin"	heme oxygenase		0.160567749
LMEPYDVIVDGTDNFPTR	cce_2667	"Biosynthesis of cofactors	prosthetic groups	and carriers: Molybdopterin"	molybdopterin biosynthesis MoeB protein	0.063853188	0.070287373	0.109909573	0.105339988	0.154360416	0.178160276	0.206585848	0.232913939	0.27446024	0.264654588	0.293882077
IGIVDFDIVDSSNLQR	cce_2667	"Biosynthesis of cofactors	prosthetic groups	and carriers: Molybdopterin"	molybdopterin biosynthesis MoeB protein	0.085528231	0.094462407	0.139717174	0.395515754	0.198315086	0.216624233	0.255223295	0.278576038	0.454003689	0.434517309	0.33463679
KVEMGSVNAVVTLEVAPGVEISGMITK	cce_0844	"Biosynthesis of cofactors	prosthetic groups	and carriers: Molybdopterin"	molybdenum-pterin binding protein								0.019626688	0.031803413		0.039764758
DATPEAIKPLLDKEIEGFGEIFR	cce_4837	"Biosynthesis of cofactors	prosthetic groups	and carriers: Molybdopterin"	molybdenum cofactor biosynthesis protein B											0.059593026
LLLYNAWDMSFR	cce_2667	"Biosynthesis of cofactors	prosthetic groups	and carriers: Molybdopterin"	molybdopterin biosynthesis MoeB protein											0.974179832
ILQDAGINGTNVK	cce_2667	"Biosynthesis of cofactors	prosthetic groups	and carriers: Molybdopterin"	molybdopterin biosynthesis MoeB protein										0.101909931
AAIPEISVTDLK	cce_2667	"Biosynthesis of cofactors	prosthetic groups	and carriers: Molybdopterin"	molybdopterin biosynthesis MoeB protein										0.660827022
IAVLTVSDTRTEADDKSGK	cce_4837	"Biosynthesis of cofactors	prosthetic groups	and carriers: Molybdopterin"	molybdenum cofactor biosynthesis protein B			0.009822205
ESAESLALSEGK	cce_0844	"Biosynthesis of cofactors	prosthetic groups	and carriers: Molybdopterin"	molybdenum-pterin binding protein	0.018317681
VTVIWWTHAINGLHENDFIMAAK	cce_2226	"Biosynthesis of cofactors	prosthetic groups	and carriers: Others"	putative pterin-4-alpha-carbinolamine dehydratase				0.04003981	0.042938787	0.074946562	0.065411746	0.062112138	0.095047036	0.092677988	0.0775792
LAPPIPDFPGNITIDITR	cce_4420	"Biosynthesis of cofactors	prosthetic groups	and carriers: Others"	dihydroneopterin aldolase								0.057165694	0.055521081	0.053958985
HGIDVNPHGTQVDYVWVPGSFEVPLVAR	cce_4679	"Biosynthesis of cofactors	prosthetic groups	and carriers: Riboflavin"	"6	7-dimethyl-8-ribityllumazine synthase	riboflavin synthase beta subunit"
GQVTPNNSQASLPVSQMKNPMISE	cce_4679	"Biosynthesis of cofactors	prosthetic groups	and carriers: Riboflavin"	"6	7-dimethyl-8-ribityllumazine synthase	riboflavin synthase beta subunit"
TMSYENVPSAVFSTPEAATVGLTEAEAKEQYGEDAIKVYR	cce_4626	"Biosynthesis of cofactors	prosthetic groups	and carriers: Thioredoxin	glutaredoxin	and glutathione"	glutathione reductase	0.018985941		0.019036174	0.014992018	0.025659988
DKILNGFDEDIR	cce_4626	"Biosynthesis of cofactors	prosthetic groups	and carriers: Thioredoxin	glutaredoxin	and glutathione"	glutathione reductase
IAVQGDQNNEMVLADTIGLAATGR	cce_4626	"Biosynthesis of cofactors	prosthetic groups	and carriers: Thioredoxin	glutaredoxin	and glutathione"	glutathione reductase									0.027856725
KLMVYTSHFPAQFQESQGYGWSPVK	cce_4626	"Biosynthesis of cofactors	prosthetic groups	and carriers: Thioredoxin	glutaredoxin	and glutathione"	glutathione reductase	0.022059467	0.069100333	0.017483195	0.029989007	0.040103498	0.029828518	0.026735362	0.039971395	0.041381851
KPLSTQPSSGDSPTTIDIE	cce_0174	"Biosynthesis of cofactors	prosthetic groups	and carriers: Thioredoxin	glutaredoxin	and glutathione"	glutathione S-transferase	0.017853365	0.019531672	0.016720196	0.022520736	0.03708054	0.033384474	0.038498572	0.042930773	0.040234767
MITAVNQETERLNGIYQR	cce_4626	"Biosynthesis of cofactors	prosthetic groups	and carriers: Thioredoxin	glutaredoxin	and glutathione"	glutathione reductase		0.033416609	0.031730366	0.047613076	0.084714227	0.051109592	0.078360921	0.107055581	0.081253535
KIEVTPGVGQVDLYK	cce_0174	"Biosynthesis of cofactors	prosthetic groups	and carriers: Thioredoxin	glutaredoxin	and glutathione"	glutathione S-transferase	0.025529525	0.028036504	0.029964273	0.037348372	0.044282114	0.067226054	0.055996603	0.068748959	0.082505463
VVKLNTDENPNTASQYGIR	cce_3988	"Biosynthesis of cofactors	prosthetic groups	and carriers: Thioredoxin	glutaredoxin	and glutathione"	thioredoxin	0.034334331	0.028477591	0.032104276	0.037031058	0.074889394	0.089092175	0.089007913	0.089069858	0.077665829
GLGSDVIQIIR	cce_4626	"Biosynthesis of cofactors	prosthetic groups	and carriers: Thioredoxin	glutaredoxin	and glutathione"	glutathione reductase	0.03229294	0.043317537			0.092684828			0.122043372	0.102700871
EVPDFLK	cce_0174	"Biosynthesis of cofactors	prosthetic groups	and carriers: Thioredoxin	glutaredoxin	and glutathione"	glutathione S-transferase			0.019940547	0.028071997	0.030718423	0.020043899	0.044848982	0.076426056	0.044208872
LNTDENPNTASQYGIR	cce_3988	"Biosynthesis of cofactors	prosthetic groups	and carriers: Thioredoxin	glutaredoxin	and glutathione"	thioredoxin	0.028515476	0.030607958	0.041228196	0.049638358	0.069929424	0.092288744	0.092205382	0.113120859	0.119644697
TTIQESMEHHGIQILK	cce_4626	"Biosynthesis of cofactors	prosthetic groups	and carriers: Thioredoxin	glutaredoxin	and glutathione"	glutathione reductase	0.030211119	0.028394255	0.014908505	0.030766161		0.100574083	0.078139617	0.101240847	0.069617073
VVKLEVDPNPESR	cce_1030	"Biosynthesis of cofactors	prosthetic groups	and carriers: Thioredoxin	glutaredoxin	and glutathione"	thioredoxin
SIPTLMIFK	cce_3988	"Biosynthesis of cofactors	prosthetic groups	and carriers: Thioredoxin	glutaredoxin	and glutathione"	thioredoxin	0.042677269	0.057531443	0.071850141	0.078289745	0.107603783	0.14013882	0.179657577	0.188280451	0.203673526